PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA46G00132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 264aa    MW: 30560.6 Da    PI: 5.6681
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA46G00132genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.34.9e-177821897
                --HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3 18 lpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                +p ++  eh ++++ +kt +l+ + g sW+vk+   +k++++++++GW++Fv++n+Lk+ +f++F +dg ++fe ++  +
  AA46G00132  7 IPVSYY-EH-LSPRMNKTAILQGSGGCSWKVKI--VRKGKEVYFGQGWEKFVEDNHLKDMEFLTFVYDGVHTFEVTIYGR 82
                788888.45.33567889***************..999999***************************999997666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086313.902183IPR003340B3 DNA binding domain
SMARTSM010191.1E-10283IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-19685IPR015300DNA-binding pseudobarrel domain
PfamPF023621.9E-14682IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-19785IPR015300DNA-binding pseudobarrel domain
CDDcd100171.55E-14780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MYVEQLIPVS YYEHLSPRMN KTAILQGSGG CSWKVKIVRK GKEVYFGQGW EKFVEDNHLK  60
DMEFLTFVYD GVHTFEVTIY GRDGCKETRA TMEVDTEEDL HSVYSPSSEE TRSAMEVDTE  120
EDLDCDSVYT LSTEDAANSV ESEMEIKSRK EKTKIANPET YLDDPKNLFF ETKLKNRKYE  180
LLVHSQLVKD YSLKFADRID YIFEGGKLSA KTANWSDQRV CIKRWGQVCE KIKVKKDDPI  240
LCELLSTQNV VHAIKIHVIR NKHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1yel_A1e-1378526104At1g16640
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882451.12e-78transcriptional factor B3 family protein
SwissprotQ9M8K22e-78REM21_ARATH; B3 domain-containing protein REM21
TrEMBLD7L4S82e-78D7L4S8_ARALL; Transcriptional factor B3 family protein
STRINGfgenesh1_pm.C_scaffold_30004947e-78(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15612380
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06160.11e-79B3 family protein